PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT18370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 149aa    MW: 15950 Da    PI: 10.6543
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT18370genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.5e-1787132147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      + +WT eEd  l   v+++G+g+W+++a +++ gR++kqc++rw + 
         EMT18370  87 KRPWTVEEDTMLRAKVHEFGKGRWAKVALYFP-GRSGKQCRERWINQ 132
                      579*****************************.***********985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.92682137IPR017930Myb domain
SMARTSM007177.4E-1686135IPR001005SANT/Myb domain
PfamPF002491.6E-1687132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2087136IPR009057Homeodomain-like
SuperFamilySSF466891.08E-1787139IPR009057Homeodomain-like
CDDcd001671.62E-1689131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MAASAVGNHY KSFGHGDVAH FVHNDGGASA GVVVVPGTGS RGSGGIREMD PTSFPSYGSS  60
NAPTAIAAPA RVPPRARSSG QGLARLKRPW TVEEDTMLRA KVHEFGKGRW AKVALYFPGR  120
SGKQCRERWI NQLDPNIEVI LPNLNFLTP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLR7WE051e-107R7WE05_AEGTA; Myb protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2265446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.26e-15myb domain protein 3r-4